PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.05G112200.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 264aa    MW: 29882.8 Da    PI: 9.5495
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.05G112200.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP135.71.5e-42108184177
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                          +Cqv gC++dls++k+y++rhkvCevhsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Manes.05G112200.5.p 108 ICQVYGCHKDLSSLKDYNKRHKVCEVHSKTPKVIVNGVEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 184
                          5**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-34102170IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.206106183IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.46E-40107187IPR004333Transcription factor, SBP-box
PfamPF031103.4E-32109182IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MESLRYSAEG KGLVFSDEID LSIDSFGRSR KSFTRWDGDS VENMEFIDLG FSEMPIKPFN  60
GNNTGRLADG KEAPNSKFLK ERSVVSSTSP NFQAKKTRTM SSRSQTPICQ VYGCHKDLSS  120
LKDYNKRHKV CEVHSKTPKV IVNGVEQRFC QQCSRFHLLV EFDDGKRSCR KRLAGHNERR  180
RKPQFGALSG TKYLGTSMPK RASFLFPNIL PGGILYPERY EETNCCRPVK LEDISINSTN  240
GHRITEPGPF CWNYNGYALH QSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291081821084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512054.11e-103PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
TrEMBLB9REB51e-103B9REB5_RICCO; LIGULELESS1 protein, putative
STRINGPOPTR_0008s09750.12e-90(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-51SBP family protein